PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P00770_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 499aa    MW: 55109.8 Da    PI: 8.4828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P00770_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-17184230148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             +g WT+eEd llv +vkq+G + W+ Ia+ +  gR +kqc++rw+++l
  GSMUA_Achr10P00770_001 184 KGQWTAEEDSLLVGLVKQHGVRKWSYIAKNLV-GRIGKQCRERWHNHL 230
                             799*****************************.*************97 PP

2Myb_DNA-binding62.87.1e-20237278245
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
         Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                             + WT+eE+ +lv+a+ ++G++ W+ Ia++m+ gR+++++k++w+
  GSMUA_Achr10P00770_001 237 DMWTEEEERRLVEAHMKYGNR-WAEIAKHMP-GRSENSIKNHWN 278
                             67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.363179234IPR017930Myb domain
SuperFamilySSF466895.75E-31181277IPR009057Homeodomain-like
SMARTSM007178.4E-14183232IPR001005SANT/Myb domain
PfamPF002491.0E-14184230IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-27185237IPR009057Homeodomain-like
CDDcd001677.60E-14187230No hitNo description
SMARTSM007177.3E-18235283IPR001005SANT/Myb domain
PROSITE profilePS5129421.179235285IPR017930Myb domain
PfamPF002494.1E-18237278IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-22238283IPR009057Homeodomain-like
CDDcd001674.07E-16239281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MREELKRYEP WRLHSRPMRA GSTAVFGSLL LLMVTYGGNG PKAMNPRFLR NCSLPHCLPP  60
SSPVPTPMSS TNPFFLSLFL DMEAAAGGRD GFGGKSWPPP PLMPLGNVLS GSYREEPWAH  120
HHADGAIGTL PDGILLNDSS FYADLGSGSC ENKVVKREVC RERHQARSSS SSSNGDAAAA  180
NVVKGQWTAE EDSLLVGLVK QHGVRKWSYI AKNLVGRIGK QCRERWHNHL RPDIKKDMWT  240
EEEERRLVEA HMKYGNRWAE IAKHMPGRSE NSIKNHWNAT KRRLNAKRSK RKAPKGGRCP  300
PSILQDYIRS KTFDLSKTCS TKTSPSTMSN QLDHVAYPGT QNPSSAHNST SSAAEDIFPY  360
MQKIPDQGEE ETHDPCMHDS LHVLIFNDED DFDFLPIRDA PAQVFGSSGN LSDSNGSSHL  420
HPPYLLNGAP ASSTGVLVGM DDLKAQASWS SKRDLDLVEM LSLQFSSSRS SSSSNSTPLN  480
TNPSSAFECR VGQVFSTHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-431822832103C-Myb DNA-Binding Domain
1msf_C2e-431822832103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280290KRRLNAKRSKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009419752.10.0PREDICTED: uncharacterized protein LOC103999667
TrEMBLM0REA40.0M0REA4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P00770_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.17e-57myb domain protein 119